PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC020669.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 213aa    MW: 23310 Da    PI: 8.7864
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC020669.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.6e-3199154156
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   k r+ W+p LH+rF++a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  EcC020669.10  99 KRRRSWSPALHQRFLDALQQLGGPQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 154
                   6799**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.78196156IPR017930Myb domain
SuperFamilySSF466892.87E-1696157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-2897157IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2699154IPR006447Myb domain, plants
PfamPF002494.8E-8101152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006979Biological Processresponse to oxidative stress
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0004601Molecular Functionperoxidase activity
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
IVEEQKLAAC EDQSQFRTCE SRNADARQSH PLFPSAMASG ELAEIPLHGF LSLGVGIKNP  60
SEESSSSTGT VSGRSRTISS VDCNAPSSSR GGNQQTAKKR RRSWSPALHQ RFLDALQQLG  120
GPQVATPKQI RELMQVDGLT NDEVKSHLQK YRLHNQRHPI KAFRSQKSGI QTVLPMATDI  180
SGDSLKMTGP QSPSPQSSFH HCGESWVDLP HCQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028507.11e-130PREDICTED: uncharacterized protein LOC104418763
TrEMBLA0A059ANG41e-131A0A059ANG4_EUCGR; Uncharacterized protein
STRINGVIT_03s0063g01060.t012e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.28e-29G2-like family protein